Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ergic1)

This Recombinant Xenopus laevis Endoplasmic reticulum-Golgi intermediate compartment protein 1 (ergic1) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, ERGIC-32

UniProt

Q6NS19

Expression Region

1-290

Origin

Xenopus laevis (African clawed frog)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFITFLFLSELTGFIANEIVNELYVDD PDKDSGGKIDVTLNVTLPNLPCEVVGLDIQDEMGRHEVGHIDNSMKIPINNAYGCRFEGL FSINKVPGNFHVSTHSAIAQPANPDMRHIIHKLSFGNTLQVDNIHGAFNALGGADKLASK ALESHDYVLKIVPTVYEDLNGKQQFSYQYTVANKAYVAYSHTGRVVPAIWFRYDLSPITV KYTERRQPMYRFITTVCAIIGGTFTVAGILDSFIFTASEAWKKIQLGKMQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FAM21A Antibody
NBP2-68768-25ul 25 µL

Rabbit Polyclonal FAM21A Antibody

Sign In for Pricing
View Details
TRAF6 Antibody - C - terminal region : Biotin (OAPB00191-Biotin)
OAPB00191-100UG-Biotin 0.1 mg

TRAF6 Antibody - C - terminal region : Biotin (OAPB00191-Biotin)

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944225-01 48 Well

Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944225-02 96 Well

Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944225-03 5x 96 Well

Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details
Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit
MBS9944225-04 10x 96 Well

Sheep Serine/Threonine-Protein Phosphatase 4 Regulatory Subunit 1 (PPP4R1) ELISA Kit

Sign In for Pricing
View Details