Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf71 (C3orf71)

This Recombinant Human Uncharacterized protein C3orf71 (C3orf71) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf71

UniProt

Q8N7S6

Expression Region

1-290

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLGQRAGDGERPGLPGDGEGGVPARPGRRAERPPQRPAKVNKAVTCAAHLPGAAASRPLS PNKPDRVRPGQRDRIGAKRQRRRRADAGQARAASSRRVVPTAPEVLGAVASLPDRGRPTV ARVATGSRLEGLFSAASLKLSALTQSLTRVRQAPTASGATIRLPASPVEMFLTSAFLTGF SFHCLYSGIGHGEDILASVEQITIVSRPLSGQRGAGPGNSAYTPRRSQGGPRAATTPGFR FPCRGLVRRAVLRLTVTVQDCILTALLAVSFHSIGVVIMTSSYLLGPVVK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NIPAL3 siRNA
abx925925-01 15 nmol

Mouse NIPAL3 siRNA

Sign In for Pricing
View Details
Mouse NIPAL3 siRNA
abx925925-02 30 nmol

Mouse NIPAL3 siRNA

Sign In for Pricing
View Details
Mouse Peripheral Myelin Protein 22 (PMP22) ELISA Kit
RD-PMP22-Mu-96Tests 96 Tests

Mouse Peripheral Myelin Protein 22 (PMP22) ELISA Kit

Sign In for Pricing
View Details
Human Polyadenylate-binding protein-interacting protein 1 (PAIP1) ELISA Kit
MBS283208-01 48 Tests

Human Polyadenylate-binding protein-interacting protein 1 (PAIP1) ELISA Kit

Sign In for Pricing
View Details
Human Polyadenylate-binding protein-interacting protein 1 (PAIP1) ELISA Kit
MBS283208-02 96 Tests

Human Polyadenylate-binding protein-interacting protein 1 (PAIP1) ELISA Kit

Sign In for Pricing
View Details
Human Polyadenylate-binding protein-interacting protein 1 (PAIP1) ELISA Kit
MBS283208-03 5x 96 Tests

Human Polyadenylate-binding protein-interacting protein 1 (PAIP1) ELISA Kit

Sign In for Pricing
View Details