Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 1 (Ergic1)

This Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 1 (Ergic1) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, ERGIC-32

UniProt

Q9DC16

Expression Region

1-290

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDD PDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQ FSINKVPGNFHVSTHSATAQPQNPDMTHTIHKLSFGDTLQVQNVHGAFNALGGADRLTSN PLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Sulfophthalic Acid Trisodium Salt (Contains up to 20% Positional Isomer)
TRC-S579160-2.5GG 2.5 g

4-Sulfophthalic Acid Trisodium Salt (Contains up to 20% Positional Isomer)

Sign In for Pricing
View Details
TNFRSF10D Polyclonal Antibody
E-AB-14934-01 20 µL

TNFRSF10D Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF10D Polyclonal Antibody
E-AB-14934-02 60 µL

TNFRSF10D Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF10D Polyclonal Antibody
E-AB-14934-03 120 µL

TNFRSF10D Polyclonal Antibody

Sign In for Pricing
View Details
TNFRSF10D Polyclonal Antibody
E-AB-14934-04 200 µL

TNFRSF10D Polyclonal Antibody

Sign In for Pricing
View Details
MMP17 Rabbit Polyclonal Antibody
TA362148 100 µL

MMP17 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details