Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 1 (Ergic1)

This Recombinant Mouse Endoplasmic reticulum-Golgi intermediate compartment protein 1 (Ergic1) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Endoplasmic reticulum-Golgi intermediate compartment protein 1, ER-Golgi intermediate compartment 32 kDa protein, ERGIC-32

UniProt

Q9DC16

Expression Region

1-290

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPFDFRRFDIYRKVPKDLTQPTYTGAIISICCCLFILFLFLSELTGFITTEVVNELYVDD PDKDSGGKIDVSLNISLPNLHCELVGLDIQDEMGRHEVGHIDNSMKIPLNNGAGCRFEGQ FSINKVPGNFHVSTHSATAQPQNPDMTHTIHKLSFGDTLQVQNVHGAFNALGGADRLTSN PLASHDYILKIVPTVYEDKSGKQRYSYQYTVANKEYVAYSHTGRIIPAIWFRYDLSPITV KYTERRQPLYRFITTICAIIGGTFTVAGILDSCIFTASEAWKKIQLGKIH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (and-6) -Carboxy SNARF-4F Succinimidyl Ester
21171-AAT 10x 50 µg

5- (and-6) -Carboxy SNARF-4F Succinimidyl Ester

Sign In for Pricing
View Details
S100 Calcium Binding Protein A13 (S100A13) (NM_001024211) Human Over-expression Lysate
LC422619 20 µg

S100 Calcium Binding Protein A13 (S100A13) (NM_001024211) Human Over-expression Lysate

Sign In for Pricing
View Details
LY-338979
TRC-L486650-25MG 25 mg

LY-338979

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF594 conjugate, 0.1mg/mL
BNC941758-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1758), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGD Human Gene Knockout Kit (CRISPR)
KN201729BN 1 Kit

PGD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GNB3 (NM_002075) Human Over-expression Lysate
LC431043 20 µg

GNB3 (NM_002075) Human Over-expression Lysate

Sign In for Pricing
View Details