Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 38 kDa phosphoprotein (PP38)

This Recombinant Gallid herpesvirus 2 38 kDa phosphoprotein (PP38) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

38 kDa phosphoprotein, Phosphoprotein pp38

UniProt

P68348

Expression Region

1-290

Origin

Gallid herpesvirus 2 (strain MD11/75C/R2) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEFEAEHEGLTASWVAPAPQGGKGAEGRAGVADEAGHGKTEAECAEDGEKCGDAEMSALD RVQRDRWRFSSPPPHSGVTGKGAIPIKGDGKAIECQELTGEGEWLSQWEELPPEPRRSGN EHLDESRYAKQTERGSSTGKEEGDGMKQMGELAQQCEGGTYADLLVEAEQAVVHSVRALM LAERQNPNILGEHLNKKRVLVQRPRTILSVESENATMRSYMLVTLICSAKSLLLGSCMSF FAGMLVGRTADVKTPLWDTVCLLMAFCAGIVVGGVDSGEVESGETKSESN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppm1k (NM_001107863) Rat Tagged Lenti ORF Clone
RR206175L3 10 µg

Ppm1k (NM_001107863) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)
MBS1300460-01 0.02 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)
MBS1300460-02 0.1 mg (E-Coli)

Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)
MBS1300460-03 0.02 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)
MBS1300460-04 0.1 mg (Yeast)

Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)

Sign In for Pricing
View Details
Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)
MBS1300460-05 0.02 mg (Baculovirus)

Recombinant Streptococcus agalactiae serotype III Probable transaldolase (tal)

Sign In for Pricing
View Details