Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhO (yqhO)

This Recombinant Bacillus subtilis Uncharacterized protein yqhO (yqhO) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhO, EC= 3.1.1.-

UniProt

P54513

Expression Region

1-291

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIDGVFSGGGVKGIALAGAYEVLEEKGFRFKRVAGTSAGAIIAAFIASGYTSKEIHALI EEVDGEKLLDQRYSFLPLKMLQWVSIYWRLGLYKGDTIEKWIADLLRAKGIRVFGDLQKG SLRLIASDLTNGTMIVLPDDLARYGLNPDMFPVARAVRMSCSIPYFFEPIKLKTDTGTAT VVDGGVLSNFPIWLFSKERKRPVIGVTLAPRERERPKKNIRNAFELFGALFETMKDAHDA RHIASRYEQNIIFLPVDDVMATDFHLTQQKKLALIELGKRRTELFLKQWTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ly6c Rabbit Polyclonal Antibody
HA500088 100 µL

Ly6c Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DHTKD1 Human Gene Knockout Kit (CRISPR)
KN400967 1 Kit

DHTKD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLP Recombinant Rabbit monoclonal Antibody
HA750747 100 µL

CLP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP565519 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS701593 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
SAPK4 (MAPK13) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 5H7]
AM00138PU-N 100 µg

SAPK4 (MAPK13) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 5H7]

Sign In for Pricing
View Details