Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yqhO (yqhO)

This Recombinant Bacillus subtilis Uncharacterized protein yqhO (yqhO) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Uncharacterized protein yqhO, EC= 3.1.1.-

UniProt

P54513

Expression Region

1-291

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYIDGVFSGGGVKGIALAGAYEVLEEKGFRFKRVAGTSAGAIIAAFIASGYTSKEIHALI EEVDGEKLLDQRYSFLPLKMLQWVSIYWRLGLYKGDTIEKWIADLLRAKGIRVFGDLQKG SLRLIASDLTNGTMIVLPDDLARYGLNPDMFPVARAVRMSCSIPYFFEPIKLKTDTGTAT VVDGGVLSNFPIWLFSKERKRPVIGVTLAPRERERPKKNIRNAFELFGALFETMKDAHDA RHIASRYEQNIIFLPVDDVMATDFHLTQQKKLALIELGKRRTELFLKQWTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnp2 Mouse Gene Knockout Kit (CRISPR)
KN518026 1 Kit

Tnp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR559502 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details
p-Anisaldehyde Propylene Glycol Acetal-d3
TRC-A673212-25MG 25 mg

p-Anisaldehyde Propylene Glycol Acetal-d3

Sign In for Pricing
View Details
3-Hydroxy Midostaurin
TRC-H939985-25MG 25 mg

3-Hydroxy Midostaurin

Sign In for Pricing
View Details
TPM4 (NM_001145160) Human Over-expression Lysate
LY428735 100 µg

TPM4 (NM_001145160) Human Over-expression Lysate

Sign In for Pricing
View Details
CHODL (NM_024944) Human Recombinant Protein
TP303392L 1 mg

CHODL (NM_024944) Human Recombinant Protein

Sign In for Pricing
View Details