Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspergillus clavatus Probable endonuclease lcl3 (lcl3)

This Recombinant Aspergillus clavatus Probable endonuclease lcl3 (lcl3) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Probable endonuclease lcl3, EC= 3.1.-.-

UniProt

A1CRW4

Expression Region

1-291

Origin

Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWPPWASESQAQQHNTKPPIEHNEKEHGSKSKSWESSVTAIDWAAFAEPRTIIPTVILT SGFLGAFHIHRRYLRRFPDAGSITPSHFRRRSLLGRVTSVGDGDNFRLYHTPGGRLAGWG WLPWKKVPTSKKELRDKTVHIRLAGVDAPELAHFGRPEQPFAREAHQWLTSYLLNRRVRA YIHRPDQYQRAVATVYVRRALDFPIPFRRRDVSYEMLKQGLATVYEAKWGAEFGGEAMER KYRKAEWWAKLRGTGLWKDFRRNEKEWESPRAYKTRMGLEEAVQPRVESKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-100 1x 100 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-100 1x 100 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-x (BX006 + 2H12), CF647 conjugate, 0.1mg/mL
BNC470752-100 1x 100 µL

Bcl-x (BX006 + 2H12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CALP + CNN1/832), CF640R conjugate, 0.1mg/mL
BNC400833-100 1x 100 µL

Calponin-1 (CALP + CNN1/832), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), 1mg/mL
BNUM0149-50 1x 50 µL

CD106 / VCAM1 (1.4C3), 1mg/mL

Sign In for Pricing
View Details