Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Methylsterol monooxygenase 1 (msmo1)

This Recombinant Danio rerio Methylsterol monooxygenase 1 (msmo1) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase 1, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

Q7ZW77

Expression Region

1-291

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVNGTANILSSAFLAVEFVDSFLPQNPLQEPFKHAWNHMLQNYTKFQIATWGSLIVHEL IYFLFCLPGFIFQFLPFMQKYKIQPDKPETWEKQWKCFKMLLFNHFCIQLPLICGTYYFT EFFSIPYDWDTMPRWPFLLAQCFGCAVIEDTWHYFLHRALHHRRIYKYIHKVHHDFTSPF GMQAEYAHPLETLILGAGFFIGTMVFCNHMILLWAWVTFRLLETIDVHSGYDIPLNPLHL IPFYAGARFHDFHHMNFVGNYGSTFTWWDRLFDTDSQFNKHYSHHKTAKSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL
BNC680177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-500 1x 500 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF488A conjugate, 0.1mg/mL
BNC881563-500 1x 500 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF647 conjugate, 0.1mg/mL
BNC471829-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (rIGEL/773), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgM Immunoglobulin (DA4-4), CF640R conjugate, 0.1mg/mL
BNC400759-100 1x 100 µL

Human IgM Immunoglobulin (DA4-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details