Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural proliferation differentiation and control protein 1 (NPDC1)

This Recombinant Human Neural proliferation differentiation and control protein 1 (NPDC1) spans the amino acid sequence from region 35-325.

Product Specifications

Product Name Alternative

Neural proliferation differentiation and control protein 1, NPDC-1

UniProt

Q9NQX5

Expression Region

35-325

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPR LEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPT PHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIR LTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTA SSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl Sulfapyridine-d4 (Major)
TRC-A187912-1MG 1 mg

N-Acetyl Sulfapyridine-d4 (Major)

Sign In for Pricing
View Details
N-Boc-γ-aminobutyric Acid
TRC-N656140-1G 1 g

N-Boc-γ-aminobutyric Acid

Sign In for Pricing
View Details
CD79a Rabbit Polyclonal Antibody
R1204-4 100 µL

CD79a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Phenyl-N′-(o-tolyl)-p-phenylenediamine-D9
TRC-P576881-5MG 5 mg

N-Phenyl-N′-(o-tolyl)-p-phenylenediamine-D9

Sign In for Pricing
View Details
RAB7 Recombinant Rabbit monoclonal Antibody
HA750279 100 µL

RAB7 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mesothelin (Mesothelial Marker) (MSLN/2131), CF647 conjugate, 0.1mg/mL
BNC472131-500 1x 500 µL

Mesothelin (Mesothelial Marker) (MSLN/2131), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details