Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural proliferation differentiation and control protein 1 (NPDC1)

This Recombinant Human Neural proliferation differentiation and control protein 1 (NPDC1) spans the amino acid sequence from region 35-325.

Product Specifications

Product Name Alternative

Neural proliferation differentiation and control protein 1, NPDC-1

UniProt

Q9NQX5

Expression Region

35-325

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPR LEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPT PHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIR LTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTA SSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BubR1 Antibody (pSer670): ATTO 390
SPC-929D-A390 100 µL

BubR1 Antibody (pSer670): ATTO 390

Sign In for Pricing
View Details
9,10-Dihydro-9-oxa-10-phosphaphenanthrene 10-Oxide
TRC-D679033-2.5G 2.5 g

9,10-Dihydro-9-oxa-10-phosphaphenanthrene 10-Oxide

Sign In for Pricing
View Details
ZNF35 Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF807031 100 µg

ZNF35 Mouse Monoclonal Antibody [Clone ID: OTI1D9]

Sign In for Pricing
View Details
(2-Chloroethyl) Phosphonic Acid (>85%)
TRC-C366175-1G 1 g

(2-Chloroethyl) Phosphonic Acid (>85%)

Sign In for Pricing
View Details
THAP8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F7]
TA811425BM 100 µL

THAP8 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4F7]

Sign In for Pricing
View Details
Bulk Human IgG4 (IB4) Isotype Control S228P
ICH2257S228P-20mg 20 mg

Bulk Human IgG4 (IB4) Isotype Control S228P

Sign In for Pricing
View Details