Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neural proliferation differentiation and control protein 1 (NPDC1)

This Recombinant Human Neural proliferation differentiation and control protein 1 (NPDC1) spans the amino acid sequence from region 35-325.

Product Specifications

Product Name Alternative

Neural proliferation differentiation and control protein 1, NPDC-1

UniProt

Q9NQX5

Expression Region

35-325

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPR LEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPT PHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIR LTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTA SSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGFBPL1 Rabbit Polyclonal Antibody
TA377392 100 µL

IGFBPL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAEA (NM_001017405) Human Over-expression Lysate
LC422781 20 µg

MAEA (NM_001017405) Human Over-expression Lysate

Sign In for Pricing
View Details
MIR6880 Human qPCR Primer Pair (MI0022727)
HP301483 200 Reactions

MIR6880 Human qPCR Primer Pair (MI0022727)

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS800774 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
IL16 Antibody
KC-1782-01 50 μL

IL16 Antibody

Sign In for Pricing
View Details
IL16 Antibody
KC-1782-02 100 µL

IL16 Antibody

Sign In for Pricing
View Details