Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Popeye domain-containing protein 3 (Popdc3)

This Recombinant Mouse Popeye domain-containing protein 3 (Popdc3) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9ES81

Expression Region

1-291

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKNSSLWKSLVTEHPLCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG FLSSAVWAWVDICAADIFSWNFVLFVICFMQFVHIAYQVHSITFARDFHVLYSSLFKPLG IPLPVFRTIALSSEVVSLEKEHCYAMQGKTSIDRLSVLISGRIRVTVDGEFLHYISPFQF LDSPEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA DKLYALNDRVYIGKKHHYDIRLPNYYHMSTPDLSRSPLTEQFRNSRQHCNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tsc22d2 shRNA (UAS) - Lentiviral mouseTsc22d2 shRNA (UAS, GFP) (25)
GTR15171620 1 Vial

Lentiviral mouse Tsc22d2 shRNA (UAS) - Lentiviral mouseTsc22d2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Rap1gap (NM_001256218) Mouse Tagged ORF Clone
MR231005 10 µg

Rap1gap (NM_001256218) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Histone H3 (Phospho-Tyr41) Rabbit Polyclonal Antibody
12088 100 µL

Histone H3 (Phospho-Tyr41) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KAISO Polyclonal Antibody
JOT-AP10612-01 20 µL

KAISO Polyclonal Antibody

Sign In for Pricing
View Details
KAISO Polyclonal Antibody
JOT-AP10612-02 50 μL

KAISO Polyclonal Antibody

Sign In for Pricing
View Details
KAISO Polyclonal Antibody
JOT-AP10612-03 100 µL

KAISO Polyclonal Antibody

Sign In for Pricing
View Details