Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Popeye domain-containing protein 3 (Popdc3)

This Recombinant Mouse Popeye domain-containing protein 3 (Popdc3) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9ES81

Expression Region

1-291

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKNSSLWKSLVTEHPLCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG FLSSAVWAWVDICAADIFSWNFVLFVICFMQFVHIAYQVHSITFARDFHVLYSSLFKPLG IPLPVFRTIALSSEVVSLEKEHCYAMQGKTSIDRLSVLISGRIRVTVDGEFLHYISPFQF LDSPEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA DKLYALNDRVYIGKKHHYDIRLPNYYHMSTPDLSRSPLTEQFRNSRQHCNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Surfactant Associated Protein A (SPA) ELISA Kit-Sandwich
EK5F333-01 48 Test

Mouse Surfactant Associated Protein A (SPA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Surfactant Associated Protein A (SPA) ELISA Kit-Sandwich
EK5F333-02 96 Tests

Mouse Surfactant Associated Protein A (SPA) ELISA Kit-Sandwich

Sign In for Pricing
View Details
GPR55 Rabbit pAb, BF700 conjugated
orb2891071 100 µL

GPR55 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Smarca1 ORF Vector (Mouse) (pORF)
44406014 1.0 µg DNA

Smarca1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Fish Dystrobrevin Alpha (DTNA) ELISA Kit
MBS9943286 Inquire

Fish Dystrobrevin Alpha (DTNA) ELISA Kit

Sign In for Pricing
View Details
Anti-Lactate Dehydrogenase B (LDHB) Monoclonal Antibody
TRV-0020683-01 50 Tests

Anti-Lactate Dehydrogenase B (LDHB) Monoclonal Antibody

Sign In for Pricing
View Details