Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Popeye domain-containing protein 3 (Popdc3)

This Recombinant Mouse Popeye domain-containing protein 3 (Popdc3) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9ES81

Expression Region

1-291

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKNSSLWKSLVTEHPLCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG FLSSAVWAWVDICAADIFSWNFVLFVICFMQFVHIAYQVHSITFARDFHVLYSSLFKPLG IPLPVFRTIALSSEVVSLEKEHCYAMQGKTSIDRLSVLISGRIRVTVDGEFLHYISPFQF LDSPEWDSLRPTEEGIFQVTLTADTDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA DKLYALNDRVYIGKKHHYDIRLPNYYHMSTPDLSRSPLTEQFRNSRQHCNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 750
E51S4129 100 µL

Rabbit Anti-Rat IgG (H&L) - Alexa Fluor 750

Sign In for Pricing
View Details
Entpd1 sgRNA CRISPR Lentivector set (Rat)
K7083801 3x 1.0 µg

Entpd1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Immortalized Human Prostate Smooth Muscle Cells
T0601 1x 10^6 Cells - 1.0 mL

Immortalized Human Prostate Smooth Muscle Cells

Sign In for Pricing
View Details
Antimycobacterial agent-3
T63865-01 25 mg

Antimycobacterial agent-3

Sign In for Pricing
View Details
Antimycobacterial agent-3
T63865-02 50 mg

Antimycobacterial agent-3

Sign In for Pricing
View Details
Antimycobacterial agent-3
T63865-03 100 mg

Antimycobacterial agent-3

Sign In for Pricing
View Details