Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Penicillium chrysogenum Probable endonuclease lcl3 (lcl3)

This Recombinant Penicillium chrysogenum Probable endonuclease lcl3 (lcl3) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Probable endonuclease lcl3, EC= 3.1.-.-

UniProt

B6H1W0

Expression Region

1-292

Origin

Penicillium chrysogenum (strain ATCC 28089 / DSM 1075 / Wisconsin 54-1255) (Penicillium notatum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWPPWSSESTNDEQKQTPSSWLSSAANKPSSILDWTAFTELRTIIPTVVLTSGILIAVR FHRRYLRRIPDAPSISSSYLRRRSIFGQVTSVGDGDNFRIFHTPGGRMAGWGWLPWKKVP TVKKDLKDKTIHIRLAGVDAPELAHFGRPEQPFARDAHTWLTSYLSNRRVRALVHRQDQY SRVVASVFVRRAFDFPPFRRRDVSYEMLKRGLATVYEAKIGSEFGGDKMEKKYRKAEWWA KKRARGLWKDYRRVGSGWESPREYKNRMGMGDPLPIEKGNGKGNGKGKIGQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL
BNC471231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-100 1x 100 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (LK2H10), CF740 conjugate, 0.1mg/mL
BNC740641-500 1x 500 µL

Chromogranin A (LK2H10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF568 conjugate, 0.1mg/mL
BNC681602-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details