Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clavispora lusitaniae Golgi to ER traffic protein 2 (GET2)

This Recombinant Clavispora lusitaniae Golgi to ER traffic protein 2 (GET2) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Golgi to ER traffic protein 2

UniProt

C4YCC3

Expression Region

1-292

Origin

Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSELSAEEKRKLLRERRQAKMAQGKATDRLNNILSQGSSVKSSNVTSVLDKPEKATTTVM DLPSRETQSPTPLHDDPEVPDITSLLKEKENEAPDMEAMLQQILGGSGAHTGPGNDGGAN FLQEMMKAMAEDPSGGSTAEESSYQSQLSQYHAYEQKQWKARFLVVRWIIHTLNFVYHYI ASGYKLSASPYAFVRAQAVDSHVRTFFTAFLTVEVAVISAYFLVMSQPKFKDFSRENLVS RILSMASAVVPAVGRYQPLVTRALVYWNGASIFVGDLMLMVFYFGITSVLGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF405S conjugate, 0.1mg/mL
BNC040039-500 1x 500 µL

CD34 (ICO-115), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-100 1x 100 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL
BNC400676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL
BNC680158-500 1x 500 µL

Cytokeratin 17 (E3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF405S conjugate, 0.1mg/mL
BNC040012-500 1x 500 µL

Tyrosinase (T311), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details