Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Translocase of inner mitochondrial membrane domain-containing protein 1 (timmdc1)

This Recombinant Danio rerio Translocase of inner mitochondrial membrane domain-containing protein 1 (timmdc1) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Translocase of inner mitochondrial membrane domain-containing protein 1

UniProt

Q568N3

Expression Region

1-292

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MCTAVRQDLSLKCGGTDVKQPGDSQPGHLRALLGFTLPSVYASDSSTQILPKHIGKPEFP DTGWDRIKDLFYNVEGQYTEELRNVVKSGIASAIVGMIYGGLPGARHARQRFIQCSQAEI YRNRVDAVRAAHNAAIRGFLRFGWRWSWRVAAFVTLFNTVNTGLTVYRDQNALSHFAVSG AVTGGVFRLNLGLRGLLSGTIIGVILGFPAGVLILGLQNLGGETMRDKRRRERRELHELR VTEWNARLKVTDDLIGEMSSLKHQDSEIDLQQVEELLSQPRNGNAAKGPYNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL
BNC740017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF568 conjugate, 0.1mg/mL
BNC681134-500 1x 500 µL

Mucin 5AC (MUC5AC) (MUC5AC/917 + 45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF405S conjugate, 0.1mg/mL
BNC040193-100 1x 100 µL

CD86 (BU63), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details