Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1495 (MJ1495)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1495 (MJ1495) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1495

UniProt

Q58890

Expression Region

1-292

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MILIIYLTKIMGDEMTSMDMFFFLFIFLLFIYPEMMMRYRIMKRLRCIREIERQRGTRVI AMIHRQEALTFLGIPIYKFITIEDSEEILRAIRLTPEDMPIDLIIHTPGGLALASEQIAL ALKEHKAKTTVIIPHYAMSGGSLIALAADEIIMDKNAVMGPVDPQIGQYPAASILEAYYR KGEKVSDETLILVDISKKAIKQMEEFVYELLKDKYGDEKAKEIAKKLTSGTWTHDYPLTV SKLKELGIEVNTNVPRKVYELLELYPQPMGAKPSVYYIPVPYSKKESEKNAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAX1 Antibody
orb1327224 100 µg

VAX1 Antibody

Sign In for Pricing
View Details
Arl6ip4 (BC063748) Mouse Tagged ORF Clone
MG202757 10 µg

Arl6ip4 (BC063748) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
COLGALT1 rabbit pAb Antibody
orb2305712-01 50 µL

COLGALT1 rabbit pAb Antibody

Sign In for Pricing
View Details
COLGALT1 rabbit pAb Antibody
orb2305712-02 100 µL

COLGALT1 rabbit pAb Antibody

Sign In for Pricing
View Details
Human Frizzled 2 ELISA KIT
EF009693 96 Tests

Human Frizzled 2 ELISA KIT

Sign In for Pricing
View Details
Mouse Monoclonal B7-1/CD80 Antibody (62N3G8) [Alexa Fluor 750]
NBP2-25255AF750 0.1 mL

Mouse Monoclonal B7-1/CD80 Antibody (62N3G8) [Alexa Fluor 750]

Sign In for Pricing
View Details