Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1361 (MJ1361)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1361 (MJ1361) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1361

UniProt

Q58756

Expression Region

1-292

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAYPIKTRYIKRGENFIPIVVEAIKNSGIKLEDGDFVVLSEKMVSTAEGNFIDESKFKP GVLAYLCYYWSKYLWGYVLGKLLKVKEDKIKNLRRMPKEETLKHKQTIIEIVGLRYALKP YAEGGVDLTNVPGTYACPLPKNPKKWAEELYKEIKKELGVDVVVMVADTDATYRVLNFYF TALPYAIDGIISGIGVFGFILGRLADVLKIGGFAGCTPLAIAGNEVYKKYSIGELTRIAF ICDRVHKTIKNINEVLEKYNTYVITEEILEKLEHTPVVVVKIKEEYKPESQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (Mucin 2) (MLP/2970R), CF740 conjugate, 0.1mg/mL
BNC742970-100 1x 100 µL

MUC2 (Mucin 2) (MLP/2970R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chenodeoxycholic acid-3-Beta-D-glucuronide
TRC-C291920-5MG 5 mg

Chenodeoxycholic acid-3-Beta-D-glucuronide

Sign In for Pricing
View Details
Syntaxin 12 (STX12) (C-term) Rabbit Polyclonal Antibody
AP54086PU-N 400 µL

Syntaxin 12 (STX12) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PCBP1 Rabbit Monoclonal Antibody
TA423500 100 µL

PCBP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD6 Protein (Fc Tag)
PDMH100245-01 20 µg

Recombinant Human CD6 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD6 Protein (Fc Tag)
PDMH100245-02 100 µg

Recombinant Human CD6 Protein (Fc Tag)

Sign In for Pricing
View Details