Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1361 (MJ1361)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1361 (MJ1361) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1361

UniProt

Q58756

Expression Region

1-292

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRAYPIKTRYIKRGENFIPIVVEAIKNSGIKLEDGDFVVLSEKMVSTAEGNFIDESKFKP GVLAYLCYYWSKYLWGYVLGKLLKVKEDKIKNLRRMPKEETLKHKQTIIEIVGLRYALKP YAEGGVDLTNVPGTYACPLPKNPKKWAEELYKEIKKELGVDVVVMVADTDATYRVLNFYF TALPYAIDGIISGIGVFGFILGRLADVLKIGGFAGCTPLAIAGNEVYKKYSIGELTRIAF ICDRVHKTIKNINEVLEKYNTYVITEEILEKLEHTPVVVVKIKEEYKPESQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Peforelin Trifluoroacetic Acid Salt(>90%)
TRC-P218335-5MG 5 mg

Peforelin Trifluoroacetic Acid Salt(>90%)

Sign In for Pricing
View Details
Frozen Tissue Sections, Soft tissue
CS628351 5x 5 µm

Frozen Tissue Sections, Soft tissue

Sign In for Pricing
View Details
Amplite® Colorimetric Endotoxin Detection Kit
60007-AAT 100 Tests

Amplite® Colorimetric Endotoxin Detection Kit

Sign In for Pricing
View Details
Bcl-2 (BCL2/782 + BCL2/796), Biotin conjugate, 0.1mg/mL
BNCB1023-100 1x 100 µL

Bcl-2 (BCL2/782 + BCL2/796), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rapgef6 Mouse Gene Knockout Kit (CRISPR)
KN514477 1 Kit

Rapgef6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CYP21A2 Human Gene Knockout Kit (CRISPR)
KN416416 1 Kit

CYP21A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details