Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yfhR (yhfR)

This Recombinant Uncharacterized protein yfhR (yhfR) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein yfhR

UniProt

Q8Z4M8

Expression Region

1-292

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPTPAEAESITFTAKDGT HLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLVSWLPERNVNLFMFDYRGFGESE GTPSQEGLLNDTKSAIDYVRHRADVNPERLVLLGQSLGGNNVLAAVGHCVGCANMRYADQ AGIRAIVLDSTFSSYSSIANQMIPGSGYLLDDRYSADRNIASVSPIPVLILHGTADHVIP WQDSEKLYALAREPKQKIFIPDGDHIDAFSGRYANLYRDAMINFIQTALSAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fumarase Mouse Monoclonal Antibody [Clone ID: AT3F6]
AM50626PU-N 100 µL

Fumarase Mouse Monoclonal Antibody [Clone ID: AT3F6]

Sign In for Pricing
View Details
C18orf1 (LDLRAD4) (NM_001003674) Human Over-expression Lysate
LC424094 20 µg

C18orf1 (LDLRAD4) (NM_001003674) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS802901 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Rat Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit
RDR-MCP1-Ra-01 96 Tests

Rat Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit

Sign In for Pricing
View Details
Rat Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit
RDR-MCP1-Ra-02 48 Tests

Rat Monocyte Chemotactic Protein 1 (MCP1) ELISA Kit

Sign In for Pricing
View Details
CTSO Antibody
KC-27197-01 50 μL

CTSO Antibody

Sign In for Pricing
View Details