Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein yfhR (yhfR)

This Recombinant Uncharacterized protein yfhR (yhfR) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Uncharacterized protein yfhR

UniProt

Q8Z4M8

Expression Region

1-292

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTLQHTRRIVKSLFILFIIVVCIYLLPRVAINAFYYPDNKVYGPTPAEAESITFTAKDGT HLHGWFIPTAFGRPENAVATVIHVHGNAGNMSAHWPLVSWLPERNVNLFMFDYRGFGESE GTPSQEGLLNDTKSAIDYVRHRADVNPERLVLLGQSLGGNNVLAAVGHCVGCANMRYADQ AGIRAIVLDSTFSSYSSIANQMIPGSGYLLDDRYSADRNIASVSPIPVLILHGTADHVIP WQDSEKLYALAREPKQKIFIPDGDHIDAFSGRYANLYRDAMINFIQTALSAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGD2 (Prostaglandin D2) ELISA Kit
E-EL-0066-01 24 Tests

PGD2 (Prostaglandin D2) ELISA Kit

Sign In for Pricing
View Details
PGD2 (Prostaglandin D2) ELISA Kit
E-EL-0066-02 48 Tests

PGD2 (Prostaglandin D2) ELISA Kit

Sign In for Pricing
View Details
PGD2 (Prostaglandin D2) ELISA Kit
E-EL-0066-03 96 Tests

PGD2 (Prostaglandin D2) ELISA Kit

Sign In for Pricing
View Details
STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), Biotin conjugate, 0.1mg/mL
BNCB2410-100 1x 100 µL

STAT6 (Solitary Fibrous Tumor Marker) (STAT6/2410), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDX2 Human Gene Knockout Kit (CRISPR)
KN204883BN 1 Kit

CDX2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FBP1 Rabbit Monoclonal Antibody
TA424134 100 µL

FBP1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details