Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Azorhizobium caulinodans Cbb3-type cytochrome c oxidase subunit FixP (fixP)

This Recombinant Azorhizobium caulinodans Cbb3-type cytochrome c oxidase subunit FixP (fixP) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Cbb3-type cytochrome c oxidase subunit FixP, Cbb3-Cox subunit FixP, C-type cytochrome FixP, Cyt c (FixP), Cytochrome c oxidase subunit III

UniProt

A8HZ17

Expression Region

1-293

Origin

Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / ORS 571)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTSHESHHAPVDGAGGPSTTGHEWDGIQELNNPLPRWWLWTFYATIIWAFGYWVAYPAW PLVSNYTSGVLGWNSRSAVVEQISDLQKLRAASSAKLANVPLEDIEKNPELLSLARAEGK VAFADNCAPCHGAGGGGAKGFPNLNDDDWLWGGTLAQIQQTITHGIRSGDDEGHQGNMLA FGSILSKADISNVADYVRSLSGAAPGDTPAAKKGAEIFAANCATCHGENGKGNQELGSKN LTDGIWLYGGDKATIVQTITNGRGGVMPAWGPRLSPTTIKALTVYVHTLGGGQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF640R conjugate, 0.1mg/mL
BNC400324-500 1x 500 µL

CD53 (161-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
BNC880352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Moesin (rMSN/492), CF568 conjugate, 0.1mg/mL
BNC682307-500 1x 500 µL

Moesin (rMSN/492), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF740 conjugate, 0.1mg/mL
BNC741893-500 1x 500 µL

CD10 (Membrane Metalloendopeptidase) (MME/1893), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX8 (Renal Cell Marker) (PAX8/1492), CF488A conjugate, 0.1mg/mL
BNC881492-100 1x 100 µL

PAX8 (Renal Cell Marker) (PAX8/1492), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF568 conjugate, 0.1mg/mL
BNC681884-500 1x 500 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details