Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Methylsterol monooxygenase 1 (MSMO1)

This Recombinant Human Methylsterol monooxygenase 1 (MSMO1) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase 1, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

Q15800

Expression Region

1-293

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEA LYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFT EYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF GMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL IPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1239 (NWD2) (NM_001144990) Human Over-expression Lysate
LC428628 20 µg

KIAA1239 (NWD2) (NM_001144990) Human Over-expression Lysate

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF488A conjugate, 0.1mg/mL
BNC882295-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal) (PTH/2295R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD82 Human Knockdown Lysate
LY300476 100 µg

CD82 Human Knockdown Lysate

Sign In for Pricing
View Details
Dectin 1 (CLEC7A) (NM_197954) Human Over-expression Lysate
LC430694 20 µg

Dectin 1 (CLEC7A) (NM_197954) Human Over-expression Lysate

Sign In for Pricing
View Details
P16INK4a Recombinant Rabbit monoclonal Antibody
HA723746 100 µL

P16INK4a Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
AHR Rabbit Monoclonal Antibody [Clone ID: 23GB1635]
TA424531 100 µL

AHR Rabbit Monoclonal Antibody [Clone ID: 23GB1635]

Sign In for Pricing
View Details