Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Methylsterol monooxygenase 1 (MSMO1)

This Recombinant Human Methylsterol monooxygenase 1 (MSMO1) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase 1, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

Q15800

Expression Region

1-293

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEA LYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFT EYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF GMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL IPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp5 Mouse Gene Knockout Kit (CRISPR)
KN518808 1 Kit

Usp5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FABP3 Polyclonal Antibody
E-AB-40515-01 25 µL

FABP3 Polyclonal Antibody

Sign In for Pricing
View Details
FABP3 Polyclonal Antibody
E-AB-40515-02 100 µL

FABP3 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS710485 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/2756R), CF405S conjugate, 0.1mg/mL
BNC042756-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/2756R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALDH9A1 (C-term) Rabbit Polyclonal Antibody
AP14689PU-N 400 µL

ALDH9A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details