Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Methylsterol monooxygenase 1 (MSMO1)

This Recombinant Human Methylsterol monooxygenase 1 (MSMO1) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase 1, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

Q15800

Expression Region

1-293

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYMLNNYTKFQIATWGSLIVHEA LYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFT EYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF GMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL IPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tide Quencher™ 3 succinimidyl ester [TQ3 SE]
2230-AAT 25 mg

Tide Quencher™ 3 succinimidyl ester [TQ3 SE]

Sign In for Pricing
View Details
COLEC12 Antibody (Biotin)
KB-2295-01 50 μL

COLEC12 Antibody (Biotin)

Sign In for Pricing
View Details
COLEC12 Antibody (Biotin)
KB-2295-02 100 µL

COLEC12 Antibody (Biotin)

Sign In for Pricing
View Details
COLEC12 Antibody (Biotin)
KB-2295-03 1 mL

COLEC12 Antibody (Biotin)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS713197 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3145), CF647 conjugate, 0.1mg/mL
BNC473145-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/3145), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details