Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Translocation protein SEC62 (SEC62)

This Recombinant Candida albicans Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Translocation protein SEC62

UniProt

Q5AI21

Expression Region

1-293

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAPTPPQTGQFQVATSAQRSPVAVNIVNYLFQNPILKQRTGLLDNTNDIEFFRFKRLQR ALLSDDYKQKQQNPKNGLIPVANNEDVQKVFVLLIQNQLLLPLQKLHYAEVKAVKGWKPN KEKPTLKRADKAVMDPDVYYGWLYQKPNPYILLYSFLAIAGVFAVILFPLWPNFMKRGVW YLSMGALGLIALFFATAIVRLIIYIISLVAFPKPFWLFPNLFEDCGVIESFQPVYAWEEP KKKKGKKKKEPKLEVVEEKVGSSSGDVKVTGSELSNGSSTTGKRKVTLEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox2d Protein Vector (Mouse) (pPM-C-HA)
39541024 500 ng

Rhox2d Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Hsa-miR-6840-3p antagomir
HY-RI02244A-01 5 nmol

Hsa-miR-6840-3p antagomir

Sign In for Pricing
View Details
Hsa-miR-6840-3p antagomir
HY-RI02244A-02 20 nmol

Hsa-miR-6840-3p antagomir

Sign In for Pricing
View Details
Recombinant Mouse APOF Protein, His (Fc)-Avi-tagged
APOF-639M 50 µg

Recombinant Mouse APOF Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
B3galt1 Mouse shRNA Plasmid (Locus ID 26877)
TR502635 1 Kit

B3galt1 Mouse shRNA Plasmid (Locus ID 26877)

Sign In for Pricing
View Details
LOC389174 shRNA (h) Lentiviral Particles
sc-78454-V 200 µL

LOC389174 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details