Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Translocation protein SEC62 (SEC62)

This Recombinant Candida albicans Translocation protein SEC62 (SEC62) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Translocation protein SEC62

UniProt

Q5AI21

Expression Region

1-293

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAPTPPQTGQFQVATSAQRSPVAVNIVNYLFQNPILKQRTGLLDNTNDIEFFRFKRLQR ALLSDDYKQKQQNPKNGLIPVANNEDVQKVFVLLIQNQLLLPLQKLHYAEVKAVKGWKPN KEKPTLKRADKAVMDPDVYYGWLYQKPNPYILLYSFLAIAGVFAVILFPLWPNFMKRGVW YLSMGALGLIALFFATAIVRLIIYIISLVAFPKPFWLFPNLFEDCGVIESFQPVYAWEEP KKKKGKKKKEPKLEVVEEKVGSSSGDVKVTGSELSNGSSTTGKRKVTLEEVEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDTC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2637006 1.0 µg DNA

WDTC1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Alpha 1 Catenin/CTNNA1 Rabbit Polyclonal Antibody (Fluoro647)
orb3078726 100 µg

Alpha 1 Catenin/CTNNA1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)
MBS1451050-01 0.02 mg (E-Coli)

Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)

Sign In for Pricing
View Details
Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)
MBS1451050-02 0.02 mg (Yeast)

Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)

Sign In for Pricing
View Details
Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)
MBS1451050-03 0.1 mg (E-Coli)

Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)

Sign In for Pricing
View Details
Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)
MBS1451050-04 0.1 mg (Yeast)

Recombinant Mouse Intermediate filament tail domain-containing protein 1 (Ifltd1)

Sign In for Pricing
View Details