Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Probable E3 ubiquitin-protein ligase RNF144A-B (rnf144ab)

This Recombinant Danio rerio Probable E3 ubiquitin-protein ligase RNF144A-B (rnf144ab) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Probable E3 ubiquitin-protein ligase RNF144A-B, EC= 6.3.2.-, RING finger protein 144A-B

UniProt

Q6DH94

Expression Region

1-293

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Molecular Biology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSSRYEPSWDVDLAPLLSCKLCLGEFPLEQMTTISQCQCIFCSLCLKQYVELLIKEGLE TAISCPDSACPKQGHLLENEIECMVAGEVMQHYKRLQFEREVLLDPCRTWCPSSSCQAVC QLNEAEVQLPQPVQCPECSLRFCSACRADCHTGQACQEMLPITTFLPGENGSNLKSQEDE APIKRCPKCKVYIERDEGCAQMMCKNCKHAFCWYCLESLDDDFLLIHYDKGPCRNKLGHS RASVIWHRTQVVGIFAGFGLLLLVASPFLLLATPFVLCCKCKCKRGDDDPLPT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL
BNC940449-100 1x 100 µL

CD104 (UM-A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-100 1x 100 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL
BNC741231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL
BNC740029-100 1x 100 µL

Fibronectin (TV-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF640R conjugate, 0.1mg/mL
BNC401957-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1957R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details