Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf33 (C3orf33)

This Recombinant Human Uncharacterized protein C3orf33 (C3orf33) spans the amino acid sequence from region 2-294.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf33

UniProt

Q6P1S2

Expression Region

2-294

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGQPAATGSPSADKDGMEPNVVARISQWADDHLRLVRNISTGMAIAGIMLLLRSIRLTSK FTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGV ELAETGKAWLQKELKPSQLLWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKT VLVKGLKYDSKIYWTVHRNLLKAELTALKKGEGIWKEDSEKESYLEKFKDSWREIWKKDS FLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILKFRELISRINFRRKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC Anti-Human CD57 Antibody[HNK-1]
E-AB-F1067E-01 20 Tests

APC Anti-Human CD57 Antibody[HNK-1]

Sign In for Pricing
View Details
APC Anti-Human CD57 Antibody[HNK-1]
E-AB-F1067E-02 100 Tests

APC Anti-Human CD57 Antibody[HNK-1]

Sign In for Pricing
View Details
APC Anti-Human CD57 Antibody[HNK-1]
E-AB-F1067E-03 2x 100 Tests

APC Anti-Human CD57 Antibody[HNK-1]

Sign In for Pricing
View Details
CDCP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G5]
TA502173BM 100 µL

CDCP1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G5]

Sign In for Pricing
View Details
CF®660C F (ab') 2 fragment of Goat Anti-Rabbit IgG (H+L), 2 mg/mL
#20917-50uL 1x 50 µL

CF®660C F (ab') 2 fragment of Goat Anti-Rabbit IgG (H+L), 2 mg/mL

Sign In for Pricing
View Details
Recombinant Human TEM8/ATR Protein (Fc Tag)
PKSH030646 50 µg

Recombinant Human TEM8/ATR Protein (Fc Tag)

Sign In for Pricing
View Details