Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C3orf33 (C3orf33)

This Recombinant Human Uncharacterized protein C3orf33 (C3orf33) spans the amino acid sequence from region 2-294.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf33

UniProt

Q6P1S2

Expression Region

2-294

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AGQPAATGSPSADKDGMEPNVVARISQWADDHLRLVRNISTGMAIAGIMLLLRSIRLTSK FTSSSDIPVEFIRRNVKLRGRLRRITENGLEIEHIPITLPIIASLRKEPRGALLVKLAGV ELAETGKAWLQKELKPSQLLWFQLLGKENSALFCYLLVSKGGYFSVNLNEEILRRGLGKT VLVKGLKYDSKIYWTVHRNLLKAELTALKKGEGIWKEDSEKESYLEKFKDSWREIWKKDS FLKTTGSDFSLKKESYYEKLKRTYEIWKDNMNNCSLILKFRELISRINFRRKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM176B activation kit by CRISPRa
GA109170 1 Kit

Human TMEM176B activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Anti-Human CD352 Antibody[W19035D]
AN00321C-01 20 Tests

FITC Anti-Human CD352 Antibody[W19035D]

Sign In for Pricing
View Details
FITC Anti-Human CD352 Antibody[W19035D]
AN00321C-02 100 Tests

FITC Anti-Human CD352 Antibody[W19035D]

Sign In for Pricing
View Details
FITC Anti-Human CD352 Antibody[W19035D]
AN00321C-03 2x 100 Tests

FITC Anti-Human CD352 Antibody[W19035D]

Sign In for Pricing
View Details
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) Human Gene Knockout Kit (CRISPR)
KN424610 1 Kit

Glutamate receptor ionotropic, NMDA 2D (GRIN2D) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MFluor™ Violet 540 acid
1142-AAT 5 mg

MFluor™ Violet 540 acid

Sign In for Pricing
View Details