Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized protein C3orf33 homolog

This Recombinant Mouse Uncharacterized protein C3orf33 homolog spans the amino acid sequence from region 2-294.

Product Specifications

Product Name Alternative

Uncharacterized protein C3orf33 homolog

UniProt

Q8BN57

Expression Region

2-294

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ARPPASLGSQAPDRDRGEANVVTRVSQWADNHLRLVQNISTGMAIAGIMLLIRSVRLTSK FTTSSDIPVEFIRKKVKLRGRLQRITECGLEIEHIPITLPFISSWKEEPRGVLLVKLAGV ELTESGKVWLQAELKPSQLLWFQLLGKEDSALFCYLLVNKGGYFNVNLNEEILRRGLGKT VLVKGLNYDSKTHWKIHRNLLKAELTALKKGEGIWKEESEKESYFRKLKDSWRERWTKDN DLKPAGADLGSTKDSYHDSRRRASGKGKDSVSNYSFFLKLREFVSRLHFWRKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ULK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2587506 1.0 µg DNA

ULK2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CCDC57 (Biotin)
557604-01 50 µg

CCDC57 (Biotin)

Sign In for Pricing
View Details
CCDC57 (Biotin)
557604-02 100 µg

CCDC57 (Biotin)

Sign In for Pricing
View Details
RUFY4 (NM_198483) Human Recombinant Protein
TP316656L 1 mg

RUFY4 (NM_198483) Human Recombinant Protein

Sign In for Pricing
View Details
Human 4-Aminobutyrate Aminotransferase (ABAT) ELISA Kit
MBS9355252-01 48 Well

Human 4-Aminobutyrate Aminotransferase (ABAT) ELISA Kit

Sign In for Pricing
View Details
Human 4-Aminobutyrate Aminotransferase (ABAT) ELISA Kit
MBS9355252-02 96 Well

Human 4-Aminobutyrate Aminotransferase (ABAT) ELISA Kit

Sign In for Pricing
View Details