Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Methylsterol monooxygenase 1 (Msmo1)

This Recombinant Mouse Methylsterol monooxygenase 1 (Msmo1) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase 1, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

Q9CRA4

Expression Region

1-293

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNKSVGVFSSASLAVEYVDSLLPENPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHEA IYFLFSLPGFLFQFIPYMRKYKIQKDKPETFEGQWKCLKKILFNHFFIQLPLICGTYYFT EFFNIPYDWERMPRWYLTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF GIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL VPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTDAQYHAYIEKSKKLGKKSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP Anti-Human CD45RA Antibody[HI100]
E-AB-F1052F-01 20 Tests

PerCP Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details
PerCP Anti-Human CD45RA Antibody[HI100]
E-AB-F1052F-02 100 Tests

PerCP Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details
PerCP Anti-Human CD45RA Antibody[HI100]
E-AB-F1052F-03 2x 100 Tests

PerCP Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details
LENG1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 9H5]
TA503115AM 100 µL

LENG1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI 9H5]

Sign In for Pricing
View Details
AMIGO-1 Antibody: FITC
SMC-438D-FITC 100 µg

AMIGO-1 Antibody: FITC

Sign In for Pricing
View Details
Mouse Rbms1 activation kit by CRISPRa
GA206123 1 Kit

Mouse Rbms1 activation kit by CRISPRa

Sign In for Pricing
View Details