Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Methylsterol monooxygenase 1 (Msmo1)

This Recombinant Mouse Methylsterol monooxygenase 1 (Msmo1) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase 1, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

Q9CRA4

Expression Region

1-293

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNKSVGVFSSASLAVEYVDSLLPENPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHEA IYFLFSLPGFLFQFIPYMRKYKIQKDKPETFEGQWKCLKKILFNHFFIQLPLICGTYYFT EFFNIPYDWERMPRWYLTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF GIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL VPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTDAQYHAYIEKSKKLGKKSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF640R conjugate, 0.1mg/mL
BNC402347-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rEGP40/1110), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI7C12]
CF808901 100 µg

SAMSN1 Mouse Monoclonal Antibody [Clone ID: OTI7C12]

Sign In for Pricing
View Details
Histone H3 (mutated K27 M) Recombinant Rabbit Monoclonal Antibody [JE46-51]
HA722200 100 µL

Histone H3 (mutated K27 M) Recombinant Rabbit Monoclonal Antibody [JE46-51]

Sign In for Pricing
View Details
Cy3® goat anti-rabbit IgG (H+L) *Cross Adsorbed*
16878-AAT 1 mg

Cy3® goat anti-rabbit IgG (H+L) *Cross Adsorbed*

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1014), CF740 conjugate, 0.1mg/mL
BNC740224-500 1x 500 µL

Major Vault Protein (MVP) (1014), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DEFB123 Human Gene Knockout Kit (CRISPR)
KN423913 1 Kit

DEFB123 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details