Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Methylsterol monooxygenase 1 (Msmo1)

This Recombinant Mouse Methylsterol monooxygenase 1 (Msmo1) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Methylsterol monooxygenase 1, EC= 1.14.13.72, C-4 methylsterol oxidase

UniProt

Q9CRA4

Expression Region

1-293

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MATNKSVGVFSSASLAVEYVDSLLPENPLQEPFKNAWVYMLDNYTKFQIATWGSLIVHEA IYFLFSLPGFLFQFIPYMRKYKIQKDKPETFEGQWKCLKKILFNHFFIQLPLICGTYYFT EFFNIPYDWERMPRWYLTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF GIEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL VPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTDAQYHAYIEKSKKLGKKSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fam162a (NM_027342) Mouse Tagged ORF Clone
MG201149 10 µg

Fam162a (NM_027342) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Scopine Di(2-thienylglycolate)
TRC-S199965-1G 1 g

Scopine Di(2-thienylglycolate)

Sign In for Pricing
View Details
Antizyme inhibitor 1 (AZIN1) (NM_015878) Human Recombinant Protein
TP710283 20 µg

Antizyme inhibitor 1 (AZIN1) (NM_015878) Human Recombinant Protein

Sign In for Pricing
View Details
PHF12 Antibody
OC-428-01 50 μL

PHF12 Antibody

Sign In for Pricing
View Details
PHF12 Antibody
OC-428-02 100 µL

PHF12 Antibody

Sign In for Pricing
View Details
PHF12 Antibody
OC-428-03 1 mL

PHF12 Antibody

Sign In for Pricing
View Details