Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apocytochrome f (petA)

This Recombinant Apocytochrome f (petA) spans the amino acid sequence from region 46-338.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

P95522

Expression Region

46-338

Origin

Phormidium laminosum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYANPREATGRIVCANCHLAAKPAEIEVPQAVLPDSVFKAVVKIPYDHSVQQV QADGSKGPLNVGAVLMLPEGFTIAPEDRIPEEMKEEVGPSYLFQPYADDKQNIVLVGPLP GDQYEEIVFPVLSPNPATNKSVAFGKYSIHLGANRGRGQIYPTGEKSNNAVYNASAAGVI TAIAKADDGSAEVKIRTEDGTTIVDKIPAGPELIVSEGEEVAAGAALTNNPNVGGFGQKD TEIVLQSPNRVKGRIAFLAAITLTQILLVLKKKQVERVQAGRDDLLKAAFIAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL
BNC041820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL
BNC680352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF594 conjugate, 0.1mg/mL
BNC940322-500 1x 500 µL

CD3e (RIV9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/1131), CF640R conjugate, 0.1mg/mL
BNC401131-500 1x 500 µL

CD45RA (PTPRC/1131), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details