Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mitochondrial prohibitin complex protein 2 (phb-2)

This Recombinant Mitochondrial prohibitin complex protein 2 (phb-2) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Mitochondrial prohibitin complex protein 2, Prohibitin-2

UniProt

P50093

Expression Region

1-294

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKQGQEAMKKAIQNARGAGVGLGLVAAAGAAVYGVAQSMFTVEAGHRAIMFNRIGGLST DLYKEGLHFRIPWFQYPIIYDIRARPNQIRSPTGSKDLQMVNIGLRVLSRPNPEHLVHIY RTLGQNWEERVLPSICNEVLKGVVAKFNASQLITQRQQVSMLVRKTLIERALDFNIILDD VSLTELAFSPQYSAAVEAKQVAAQEAQRATFYVERAKQQKQEKIVQAEGEAESAKLLGEA MKNDPGFLKLRKIRAAQKIARIVSESGNKTYLPTGGLMLNIADTDYLNVTDKRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB13 Mouse Monoclonal Antibody [Clone:3F9]
E45M18990 100 µg

ASB13 Mouse Monoclonal Antibody [Clone:3F9]

Sign In for Pricing
View Details
Lhx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7176808 1.0 µg DNA

Lhx1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Tctex1d2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46430114 3x 1.0 µg

Tctex1d2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Flavobacterium psychrophilum Epoxyqueuosine reductase (queG)
MBS1089475-01 0.02 mg (E-Coli)

Recombinant Flavobacterium psychrophilum Epoxyqueuosine reductase (queG)

Sign In for Pricing
View Details
Recombinant Flavobacterium psychrophilum Epoxyqueuosine reductase (queG)
MBS1089475-02 0.02 mg (Yeast)

Recombinant Flavobacterium psychrophilum Epoxyqueuosine reductase (queG)

Sign In for Pricing
View Details
Recombinant Flavobacterium psychrophilum Epoxyqueuosine reductase (queG)
MBS1089475-03 0.1 mg (E-Coli)

Recombinant Flavobacterium psychrophilum Epoxyqueuosine reductase (queG)

Sign In for Pricing
View Details