Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus elongatus Apocytochrome f (petA)

This Recombinant Synechococcus elongatus Apocytochrome f (petA) spans the amino acid sequence from region 31-324.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q31NV8

Expression Region

31-324

Origin

Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ADWLQPQAAAAYPFWAQENYASPREATGKIVCANCHLAKKPTEVEVPHSVLPDTVFKAVV KIPYDRSSQQVLGDGSKGGLNVGAVLMLPDGFKLAPEDRISEELKEEIGNVYFTNYSADQ ENIILVGPLPGDDHQEIVFPVLSPDPAKDKNVFFGKYQIHVGGNRGRGQVYPTGQKSNNG VYTASAAGVIDAVTETASGYDIVIRKADGSTVTDAVPAGPSPIVAVGSEVAAGAALTNDP NVGGFGQIDTEIVLQSSNRVLGVIAFFFAVMLAQIMLVLKKKQVEKVQAAELNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF594 conjugate, 0.1mg/mL
BNC940164-100 1x 100 µL

CD28 (204.12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
BNC401820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-100 1x 100 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL
BNC680978-500 1x 500 µL

CD7 (T3-3A1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2952), CF740 conjugate, 0.1mg/mL
BNC742952-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details