Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycoplasma gallisepticum P32 adhesin (mgc2)

This Recombinant Mycoplasma gallisepticum P32 adhesin (mgc2) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

P32 adhesin, Cytadhesin P32

UniProt

Q49378

Expression Region

1-294

Origin

Mycoplasma gallisepticum (strain R (low / passage 15 / clone 2) )

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSLKKLKSKLVGVSFVFSGVIALGTGVGLTSEHKYEHSPTLVLHEGETNSVGPRKITSE PWFYPVVGAGAGLIVVSLLLGLGIGIPIAKKKERMMIQEREEHQKMVESLGIIEEQNKTE AIEPTEEVNTQEPTQPAGVNVANNPQMGINQPQINPQFGPNPQQRINPQCFGGPMQPNQM GMRPGFNQMPPQMGGMPPNQMGMRPGFNQMPPQMGGMPPRPNFPNQMPNMNQPRPGFRPQ PGGGVPMGNKAGGGFNHPGTPMGPNRMNFPNQGMNQPPHMAGPRAGFPPQNGPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
BNC740352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-100 1x 100 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-500 1x 500 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF568 conjugate, 0.1mg/mL
BNC680342-500 1x 500 µL

CD43 (84-3C1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details