Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease 52 (Prss52)

This Recombinant Mouse Serine protease 52 (Prss52) spans the amino acid sequence from region 28-321.

Product Specifications

Product Name Alternative

Serine protease 52, EC= 3.4.21.-, Testicular-specific serine protease 3

UniProt

Q9D9M0

Expression Region

28-321

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WVCGRRMSSRSQQLNNASAIVEGKPASAIVGGKPANILEFPWHVGIMNHGSHLCGGSILN EWWVLSASHCFDQLNNSKLEIIHGTEDLSTKGIKYQKVDKLFLHPKFDDWLLDNDIALLL LKSPLNLSVNRIPICTSEISDIQAWRNCWVTGWGITNTSEKGVQPTILQAVKVDLYRWDW CGYILSLLTKNMLCAGTQDPGKDACQGDSGGALVCNKKRNTAIWYQVGIVSWGMGCGKKN LPGVYTKVSHYVRWISKQTAKAGRPYMYEQNSACPLVLSCRAILFLYFVMFLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB3 Rabbit Polyclonal Antibody
TA366760 100 µL

ZBTB3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF488A conjugate, 0.1mg/mL
BNC883261-100 1x 100 µL

Lymphocyte Activation Gene 3 (LAG-3) (Negative Checkpoint Regulator) (LAG3/3261), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM82A1 (RMDN2) Human Gene Knockout Kit (CRISPR)
KN214471BN 1 Kit

FAM82A1 (RMDN2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF488A conjugate, 0.1mg/mL
BNC882559-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/2559R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), 0.2mg/mL
BNUB1976-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), 0.2mg/mL

Sign In for Pricing
View Details
Human C3orf15 (MAATS1) activation kit by CRISPRa
GA113950 1 Kit

Human C3orf15 (MAATS1) activation kit by CRISPRa

Sign In for Pricing
View Details