Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease 52 (Prss52)

This Recombinant Mouse Serine protease 52 (Prss52) spans the amino acid sequence from region 28-321.

Product Specifications

Product Name Alternative

Serine protease 52, EC= 3.4.21.-, Testicular-specific serine protease 3

UniProt

Q9D9M0

Expression Region

28-321

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

WVCGRRMSSRSQQLNNASAIVEGKPASAIVGGKPANILEFPWHVGIMNHGSHLCGGSILN EWWVLSASHCFDQLNNSKLEIIHGTEDLSTKGIKYQKVDKLFLHPKFDDWLLDNDIALLL LKSPLNLSVNRIPICTSEISDIQAWRNCWVTGWGITNTSEKGVQPTILQAVKVDLYRWDW CGYILSLLTKNMLCAGTQDPGKDACQGDSGGALVCNKKRNTAIWYQVGIVSWGMGCGKKN LPGVYTKVSHYVRWISKQTAKAGRPYMYEQNSACPLVLSCRAILFLYFVMFLLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FCRL6 (NM_001004310) Human Over-expression Lysate
LY424086 100 µg

FCRL6 (NM_001004310) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human SNAI1 Protein (Sumo Tag)
PDEH100613-01 20 µg

Recombinant Human SNAI1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human SNAI1 Protein (Sumo Tag)
PDEH100613-02 100 µg

Recombinant Human SNAI1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human SNAI1 Protein (Sumo Tag)
PDEH100613-03 500 µg

Recombinant Human SNAI1 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human SNAI1 Protein (Sumo Tag)
PDEH100613-04 1 mg

Recombinant Human SNAI1 Protein (Sumo Tag)

Sign In for Pricing
View Details
MMAB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B8]
TA502167BM 100 µL

MMAB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B8]

Sign In for Pricing
View Details