Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C9 (C9)

This Recombinant Human Complement component C9 (C9) spans the amino acid sequence from region 266-559.

Product Specifications

Product Name Alternative

Complement component C9, Cleaved into the following 2 chains:, 1. Complement component C9a, 2. Complement component C9b

UniProt

P02748

Expression Region

266-559

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVDDIKA LPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHL DVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLL RGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEF SVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PON2 Antibody, FITC conjugated
MBS7050097-01 0.05 mg

PON2 Antibody, FITC conjugated

Sign In for Pricing
View Details
PON2 Antibody, FITC conjugated
MBS7050097-02 0.1 mg

PON2 Antibody, FITC conjugated

Sign In for Pricing
View Details
PON2 Antibody, FITC conjugated
MBS7050097-03 5x 0.1 mg

PON2 Antibody, FITC conjugated

Sign In for Pricing
View Details
Rabbit Regulatory T cells
MBS7270383-01 48 Strip Well

Rabbit Regulatory T cells

Sign In for Pricing
View Details
Rabbit Regulatory T cells
MBS7270383-02 96 Strip Well

Rabbit Regulatory T cells

Sign In for Pricing
View Details
Rabbit Regulatory T cells
MBS7270383-03 5x 96 Strip Well

Rabbit Regulatory T cells

Sign In for Pricing
View Details