Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus neoformans var. neoformans serotype D NADH-cytochrome b5 reductase 1 (CBR1)

This Recombinant Cryptococcus neoformans var. neoformans serotype D NADH-cytochrome b5 reductase 1 (CBR1) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

NADH-cytochrome b5 reductase 1, EC= 1.6.2.2, Microsomal cytochrome b reductase

UniProt

P0CP14

Expression Region

1-294

Origin

Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) (Filobasidiella neoformans)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTIEVLAQKLAPHASFLGGLVVAAILGLFIFFQEKDRKVLDPVEWRSFKLVDKDHLSHN TALYRFALPRASDSLGLPIGQHISVAAEINGKQVVRSYTPTTLDDDKGHFDLVVKTYEKG NISRYLSLLTIGQEIKVKGPKGKFVYTPNMAPHLVMIAGGTGITPMYQIIKSSIKTPGDK TRLSLIYANIQEDDILLKKEIDELQAKSNGRFDVKYVLNNPPEGWTGGVGFVTKEMIEEA MPSSGVGSANHGEGHKVLMCGPPPMITAMKGHLAQIGYPAPRSVSKLEDQVFLF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNLIP, CT (PNLIP, Pancreatic triacylglycerol lipase)
MBS647717-01 0.2 mL

PNLIP, CT (PNLIP, Pancreatic triacylglycerol lipase)

Sign In for Pricing
View Details
PNLIP, CT (PNLIP, Pancreatic triacylglycerol lipase)
MBS647717-02 5x 0.2 mL

PNLIP, CT (PNLIP, Pancreatic triacylglycerol lipase)

Sign In for Pricing
View Details
Collagen II/COL2A1 Rabbit Polyclonal Antibody (Cy3)
orb2575087 100 µg

Collagen II/COL2A1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Hpd sgRNA CRISPR Lentivector set (Mouse)
K3368801 3x 1.0 µg

Hpd sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
BST2 Polyclonal Antibody, Biotin Conjugated
bs-9850R-Biotin 100 µL

BST2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Constitutive androstane receptor Rabbit Polyclonal Antibody (RBITC)
orb1063586 100 µL

Constitutive androstane receptor Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details