Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01200 (AtMg01200)

This Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg01200 (AtMg01200) spans the amino acid sequence from region 1-294.

Product Specifications

Product Name Alternative

Uncharacterized mitochondrial protein AtMg01200, ORF294

UniProt

P92550

Expression Region

1-294

Origin

Arabidopsis thaliana (Mouse-ear cress)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITRLFAQLVSLSIVTYWNDAIVATNFSWLFITFFVMTFTFRTFSRYFKKPIIWTLYFFL CLIAFLLLWAARIHINILFSFAFGDVYSFFMAGVFLFYGFGELLPIGSDSDVGEASWVVN PATGASGSGGNGWTESAANDPAREVSLAPFPPQLTHPVPFPAEPGSPDPVSPPPPIASFY SRIERAESLHAGNIELAEDLQRIQEMERNLENERSPYRGRELAARIDWEVRELEGKVARN RAWDMVRDAQLDIWRQGLDQELVRQQENESRLEERRFQSHSTNSLFEADSSRDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL
BNC040978-500 1x 500 µL

CD7 (T3-3A1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-500 1x 500 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-100 1x 100 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
BNC940009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL
BNC471919-100 1x 100 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details