Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Prohormone-3

This Recombinant Apis mellifera Prohormone-3 spans the amino acid sequence from region 20-314.

Product Specifications

Product Name Alternative

Prohormone-3, Cleaved into the following chain:, 1. Brain peptide ITGQGNRIF

UniProt

P85828

Expression Region

20-314

Origin

Apis mellifera (Honeybee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RRLGNEYIEQDRPPCGTSGHPGSIRPTEMKTMTFGLNDEERAKHPRESEVLNENGAARFQ QRYTHMGQKMYTCVALTVVALVSTMHFGVEAWGGLFNRFSPEMLSNLGYGSHGDHISKSG LYQRPLSTSYGYSYDSLEEVIPCYERKCTLNEHCCPGSICMNVDGDVGHCVFELGQKQGE LCRNDNDCETGLMCAEVAGSETRSCQVPITSNKLYNEECNVSGECDISRGLCCQLQRRHR QTPRKVCSYFKDPLVCIGPVATDQIKSIVQYTSGEKRITGQGNRIFKRSLKAPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(1,6-Dihydro-6-oxo-1-phenyl-3-pyridinecarboxylate)-β-D-glucopyranuronic Acid
TRC-D181233-25MG 25 mg

1-(1,6-Dihydro-6-oxo-1-phenyl-3-pyridinecarboxylate)-β-D-glucopyranuronic Acid

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF594 conjugate, 0.1mg/mL
BNC941919-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rCD30/412), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF647 conjugate, 0.1mg/mL
BNC471968-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (TGB/1968R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ATPase (Ab-16) Antibody
8B0458-AAT 50 µg

ATPase (Ab-16) Antibody

Sign In for Pricing
View Details
CK-16 Monoclonal Antibody
E-AB-22019-01 20 µL

CK-16 Monoclonal Antibody

Sign In for Pricing
View Details
CK-16 Monoclonal Antibody
E-AB-22019-02 60 µL

CK-16 Monoclonal Antibody

Sign In for Pricing
View Details