Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Prohormone-3

This Recombinant Apis mellifera Prohormone-3 spans the amino acid sequence from region 20-314.

Product Specifications

Product Name Alternative

Prohormone-3, Cleaved into the following chain:, 1. Brain peptide ITGQGNRIF

UniProt

P85828

Expression Region

20-314

Origin

Apis mellifera (Honeybee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RRLGNEYIEQDRPPCGTSGHPGSIRPTEMKTMTFGLNDEERAKHPRESEVLNENGAARFQ QRYTHMGQKMYTCVALTVVALVSTMHFGVEAWGGLFNRFSPEMLSNLGYGSHGDHISKSG LYQRPLSTSYGYSYDSLEEVIPCYERKCTLNEHCCPGSICMNVDGDVGHCVFELGQKQGE LCRNDNDCETGLMCAEVAGSETRSCQVPITSNKLYNEECNVSGECDISRGLCCQLQRRHR QTPRKVCSYFKDPLVCIGPVATDQIKSIVQYTSGEKRITGQGNRIFKRSLKAPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Infant Incubator BIIC-802
BIIC-802 1 Unit

Infant Incubator BIIC-802

Sign In for Pricing
View Details
CD171/N-CAML1 (Ab-1181) Antibody
8B0841-AAT 50 µg

CD171/N-CAML1 (Ab-1181) Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-370-01 50 μL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-370-02 100 µL

TNF Antibody

Sign In for Pricing
View Details
TNF Antibody
KC-370-03 1 mL

TNF Antibody

Sign In for Pricing
View Details
HOXD1 (N-term) Rabbit Polyclonal Antibody
AP52083PU-N 400 µL

HOXD1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details