Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Apis mellifera Prohormone-3

This Recombinant Apis mellifera Prohormone-3 spans the amino acid sequence from region 20-314.

Product Specifications

Product Name Alternative

Prohormone-3, Cleaved into the following chain:, 1. Brain peptide ITGQGNRIF

UniProt

P85828

Expression Region

20-314

Origin

Apis mellifera (Honeybee)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RRLGNEYIEQDRPPCGTSGHPGSIRPTEMKTMTFGLNDEERAKHPRESEVLNENGAARFQ QRYTHMGQKMYTCVALTVVALVSTMHFGVEAWGGLFNRFSPEMLSNLGYGSHGDHISKSG LYQRPLSTSYGYSYDSLEEVIPCYERKCTLNEHCCPGSICMNVDGDVGHCVFELGQKQGE LCRNDNDCETGLMCAEVAGSETRSCQVPITSNKLYNEECNVSGECDISRGLCCQLQRRHR QTPRKVCSYFKDPLVCIGPVATDQIKSIVQYTSGEKRITGQGNRIFKRSLKAPFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B Raf (BRAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C5]
TA500444AM 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4C5]

Sign In for Pricing
View Details
CT47A10 (NM_001080137) Human Over-expression Lysate
LY421593 100 µg

CT47A10 (NM_001080137) Human Over-expression Lysate

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone ID: OTI8B2]
CF805248 100 µg

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody [Clone ID: OTI8B2]

Sign In for Pricing
View Details
Xrcc4 Mouse Gene Knockout Kit (CRISPR)
KN519523 1 Kit

Xrcc4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GADD45G (NM_006705) Human Recombinant Protein
TP720527 10 µg

GADD45G (NM_006705) Human Recombinant Protein

Sign In for Pricing
View Details
Human TEDC2 activation kit by CRISPRa
GA112853 1 Kit

Human TEDC2 activation kit by CRISPRa

Sign In for Pricing
View Details