Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phaeosphaeria nodorum Probable endonuclease LCL3 (LCL3)

This Recombinant Phaeosphaeria nodorum Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

Q0UVH1

Expression Region

1-296

Origin

Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) (Glume blotch fungus) (Septoria nodorum)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRWFGSGDDEKKKKQVGETWADSLRADSWGQSLTNPRTLIPTFAFTITTVTALRLYKTFL RRIPTVNHVKPHYFRRKGIFGKVTTVGDADNFRLYHTPGGRIAGWGWLPWKMVPTKREGL SNQTVGLPCHLGLLSIVSDSPSLVANNFQLHIRLAGVDAPELAHWGREEQPYAKEAQEWL INLIHNRRVRAYIYRRDQYDRIVAQVYVRRWLFRKDVGLEMLKAGLATIYEAKSGAEFGT SEAKYRAAEEKAKAQKVGMWAKPTLLQKLGGASTKAPESPREYKARHAAADKLKKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-500 1x 500 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF647 conjugate, 0.1mg/mL
BNC470152-500 1x 500 µL

CD11c (HC1/1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF405M conjugate, 0.1mg/mL
BNC052066-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (rPTPRC/1460), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF647 conjugate, 0.1mg/mL
BNC472406-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/2406), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details