Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 169 (Tmem169)

This Recombinant Mouse Transmembrane protein 169 (Tmem169) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Transmembrane protein 169

UniProt

Q8BG50

Expression Region

1-297

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEESAPVESQGQLPSPHHGSLRRAVAAVLALDGESTLGRRKKRRKDSRPESIIIYRSDNE KTDEEPEESEGGDRPKEEEGEDFLDYPGDDGVWNMPLDSRYVTLTGTITRGKKKGQMVDI HVTLTEKELQELTKPKELSREAAPEGRRACQVGADQGPHVVLWTLVCLPVVFVLSFVVSF YYGTITWYNIFLVYNEERTFWHKISCCPCLILFYPVLIMTMASSLGLYAAVAQLSWSWAA WWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISGNLSNKDPIQEVETSTV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Usp17la activation kit by CRISPRa
GA201150 1 Kit

Mouse Usp17la activation kit by CRISPRa

Sign In for Pricing
View Details
9030619P08Rik Mouse Gene Knockout Kit (CRISPR)
KN500504 1 Kit

9030619P08Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bri3 (NM_018772) Mouse Tagged ORF Clone
MG200643 10 µg

Bri3 (NM_018772) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SULT4A1 Human Gene Knockout Kit (CRISPR)
KN206314LP 1 Kit

SULT4A1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human ENOX1 activation kit by CRISPRa
GA110490 1 Kit

Human ENOX1 activation kit by CRISPRa

Sign In for Pricing
View Details
SNCA Polyclonal Antibody
E-AB-16253-01 20 µL

SNCA Polyclonal Antibody

Sign In for Pricing
View Details